Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u9zB_

Fold library idPDB HeaderMoleculeTitle
c5u9zB_2.00PDB header: transferaseChain: B: PDB Molecule: phosphoglycerol transferase;


Added to library: Sat Dec 23 10:26:03 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GXEKPTNYSQETIASIAQKYQKLAEDINKDRKNNIADQTVIYLLSESLSDPDRVSNVTVSHDVLPNIKAI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)




TT
STS

B
GGGSTT


GGGSTTSS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence KNSTTAGLXQSDSYGGGTANXEFQTLTSLPFYNFSSSVSVLYSEVFPKXAKPHTISEFYQGKNRIAXHPA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS
SSSS




GGGS
TT
S
TGGG
SS


GGGGS
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SANNFNRKTVYSNLGFSKFLALSGSKDKFKNIENVGLLTSDKTVYNNILSLINPSESQFFSVITXQNHIP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTGGGTT
SSSS


SS

BSSSSB


TTS



TTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence WSSDYPEEIVAEGKNFTEEENHNLTSYARLLSFTDKETRAFLEKLTQINKPITVVFYGDHLPGLYPDSAF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




STT

TT

TTSSS
SS

TTS
GGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NKHIENKYLTDYFIWSNGTNEKKNHPLINSSDFTAALFEHTDSKVSPYYALLTEVLNKASVDKSPDSPEV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT
GGGGGSS






SGGGTTB


SSTTS
S
S
 .........360.........370.........380
Sequence KAIQNDLKNIQYDVTIGKGYLLKHKTFFKI
Predicted secondary structure














SS confidence





























Known secondary structure (DSSP) TTTS

GGGG
TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D