Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u9oD_

Fold library idPDB HeaderMoleculeTitle
c5u9oD_3.37PDB header: cell cycleChain: D: PDB Molecule: plastid division protein cdp1, chloroplastic,plastid


Added to library: Sat Dec 23 08:26:05 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KRPMDTEEAEELVRQWENVKAEALGPTHQVYSLSEVLDESMLVQWQTLAQTAEAKSCYWRFVLLHLEVLQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)


STT

STB
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AHIFEDGIAGEAAEIEALLEEAAELVDESQPKNAKYYSTYKIRYILKKQEDGLWKFCQSDIQIQKLDHLD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTSSS

SSSSS


SSS








 ......
Sequence VMMARG
Predicted secondary structure

SS confidence





Known secondary structure (DSSP) GGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D