Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u9eB_

Fold library idPDB HeaderMoleculeTitle
c5u9eB_2.02PDB header: transcriptionChain: B: PDB Molecule: hth-type transcriptional activator rhar;


Added to library: Sat Dec 23 08:36:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LKLLKDDFFASDQQAVAVADVFAEHTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

SSSTT




SSTTTT
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence NDLVLQNIIYCPERLKLNLDWQGAIPGFNASAGQPHWRLGSMGMAQARQVIGQLEHESSQHVPFANEMAE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
GGG

S
S

TTSSSS
SS


TT

SSSTT
 .........150......
Sequence LLFGQLVMLLNRHRYT
Predicted secondary structure




SS confidence















Known secondary structure (DSSP)
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D