Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u8qA_

Fold library idPDB HeaderMoleculeTitle
c5u8qA_3.27PDB header: transferaseChain: A: PDB Molecule: insulin-like growth factor 1 receptor;


Added to library: Sat Mar 3 09:25:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S
S
SGGGGGGSS
S
S







S

SS
SS

BGGGT
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence IRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPP
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SS
BTTS
SS

B


TT


S


TT


STTS
TTTT
S

TT
SS

G
 .........150.........160.........170.........180.........190.........200.........210
Sequence KECGDLCPCEKTTINNEYNYRCWTTNRCQKMCPSTCACTENNECCHPECLGSCSAPDNDTACVACRHYYY
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP) GGS






TT
BSSSS
B




TT

B
SSS
B

TTSSTT
TTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEG
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TTSS

TTTTTTS
B
S

TT

B
TTSS

TT

SS
TTB

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHAL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S




STTGGGGGTT
S


S
SS
GGG

SS
S

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence VSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

TT

S



SS
BTTT

TT



S

TT



B
S
S
SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) T
SSSS
TTTB
SSSSSSS


S


SS





SSSS

SSS


 .........500.........510.........520.........530.........540.........550.........560
Sequence EYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRT
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S

S
TTT
TTS


B

SSTTS


S

SS

SS

SS





 .........570.........580.........590.........600.........610.........620.........630
Sequence NASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYARK
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)








SSTT

S


S




GGGGTS
TTT
SS







 .........640.........650.........660.........670.........680.........690.........700
Sequence VFENFLHNSIFVPRPYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAE
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)







S
SS

TT
TTTTTS










T
 .........710.........720.........730.........740.........750.........760.........770
Sequence GADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T
SS

S

TTT



SS
SS
SSS

S
S

S
 .........780.........790.........800.
Sequence NYTARIQATSLSGNGSWTDPVFFYVQAKTGY
Predicted secondary structure














SS confidence






























Known secondary structure (DSSP) SS
B






SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D