Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u8qA_

Fold library idPDB HeaderMoleculeTitle
c5u8qA_3.27PDB header: transferaseChain: A: PDB Molecule: insulin-like growth factor 1 receptor;


Added to library: Sat Mar 3 09:25:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S
S
SGGGGGGSS
S
S







S

SS
SS

BGGGT
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence IRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPP
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SS
BTTS
SS

B


TT


S


TT


STTS
TTTT
S

TT
SS

G
 .........150.........160.........170.........180.........190.........200.........210
Sequence KECGDLCPCEKTTINNEYNYRCWTTNRCQKMCPSTCACTENNECCHPECLGSCSAPDNDTACVACRHYYY
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP) GGS






TT
BSSSS
B




TT

B
SSS
B

TTSSTT
TTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEG
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TTSS

TTTTTTS
B
S

TT

B
TTSS

TT

SS
TTB

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHAL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S




STTGGGGGTT
S


S
SS
GGG

SS
S

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence VSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

TT

S



SS
BTTT

TT



S

TT



B
S
S
SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) T
SSSS
TTTB
SSSSSSS


S


SS





SSSS

SSS


 .........500.........510.........520.........530.........540.........550.........560
Sequence EYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRT
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S

S
TTT
TTS


B

SSTTS


S

SS

SS

SS





 .........570.........580.........590.........600.........610.........620.........630
Sequence NASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYARK
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)








SSTT

S


S




GGGGTS
TTT
SS







 .........640.........650.........660.........670.........680.........690.........700
Sequence VFENFLHNSIFVPRPYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAE
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)







S
SS

TT
TTTTTS










T
 .........710.........720.........730.........740.........750.........760.........770
Sequence GADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T
SS

S

TTT



SS
SS
SSS

S
S

S
 .........780.........790.........800.
Sequence NYTARIQATSLSGNGSWTDPVFFYVQAKTGY
Predicted secondary structure














SS confidence






























Known secondary structure (DSSP) SS
B






SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D