Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u71A_

Fold library idPDB HeaderMoleculeTitle
c5u71A_3.87PDB header: membrane protein, hydrolaseChain: A: PDB Molecule: cystic fibrosis transmembrane conductance regulator;


Added to library: Sat Feb 11 00:01:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALR
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)





T
TS


TTTS



TTS

SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence RCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFG
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) SSSTT



 .........150.........160.........170.........180.........190.........200.........210
Sequence LHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGL
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) S

TS

GGGTGGGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKM
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) S

TTS
TT
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQF
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) GGGGGGT


ST
 .........360.........370.........380.........390.........400.........410.........420
Sequence PWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEPVLKDINFKIERGQLLAVAGST
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S










SS

B





S
S



B
TT

T
 .........430.........440.........450.........460.........470.........480.........490
Sequence GAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TSSTSS

S

S

SS



SB
TTS


T
 .........500.........510.........520.........530.........540.........550.........560
Sequence SKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SSS
S


B
SS
SSS
S

SS
SSSS

SS

 .........570.........580.........590.........600.........610.........620.........630
Sequence ILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMTTWNTYLRYITVHKSLIFVLIWCLV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SSSSS
B

SB




TTS
S
 .........640.........650.........660.........670.........680.........690.........700
Sequence IFLAEVAASLVVLWLSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMST
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP)


TTTTTT
S


TTTSSSSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence LNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYF
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) S
TSTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence LQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRI
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TTTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence EMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEG
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) S


SS
S



 .........920.........930.........940.........950.........960.........970.........980
Sequence GQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SSTT


SS
S
TTS
T
SBTTB
SSSS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence TLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
GGG
SS



SS

SS

S
T
SSSSSS



GGGTSS

 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence HGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT
S
S
TTTS
SSSGGGSS

 .........1130.........
Sequence ENKVRQYDSIQKLLNERSL
Predicted secondary structure






SS confidence


















Known secondary structure (DSSP) TT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D