Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u2wC_

Fold library idPDB HeaderMoleculeTitle
c5u2wC_1.55PDB header: oxidoreductaseChain: C: PDB Molecule: short chain dehydrogenase;


Added to library: Thu Feb 9 12:21:52 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NRLQGKRALVTGGSRGIGAAIAKRLAADGADVAITYEKSAERAQAVVAGIEALGRRAIAIQADSADPVAV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTTT
SS
SSTT
SS
TT



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RNAVDRVAEAFGGLDILVNNAGIFRAGSLDDLTLDDIDATLNVNVRAVIVASQAAARHLGEGGRIVSTGS
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) SS










TTT

TTT

TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence CLATRVPDAGMSLYAASKAALIGWTQGLARDLGPRGITVNIVHPGSTDTDMNPADGAHADAQRSRMAIQQ
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) GGGT


STT
TTTT

SB
SSSS
TTSTTTSSS
S
 .........220.........230.........240.....
Sequence YGKADDVAALVAFVVGPEGRSINGTGLTIDGGANA
Predicted secondary structure















SS confidence


































Known secondary structure (DSSP)
B
TSTT
TT

S
STTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D