Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u2aA_

Fold library idPDB HeaderMoleculeTitle
c5u2aA_2.50PDB header: ligaseChain: A: PDB Molecule: amp-dependent synthetase and ligase;


Added to library: Fri Feb 10 13:07:21 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LDRYDDAVAQFDIAKAIALLAGNPDTGINACIECCDRYTGENRVALRAISIDNTLTELTFEDLRDMSARV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

BT

TTSSSBTTTBB
TGGGTTS


TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence GNMLADAGISAGDVVAGLLPRTPELVATILGAWRIGAIYQPLFTAFGPKAIEQRFGTSGAKLVVTNLANR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T

TT


SSTT


TT



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SKLAEVENCPRVATILAPGESLPEGDIDFRAAVAAASTECEPVMRKGSDLFMMMSTSGTAPKGVPVPLRA
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) TGGGG
TT



TT



TT
TS
S





B
TTS

S



GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence LMAFGAYMRDAVGLRSDDIFWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TS


TT


S
TTSTTT


S


TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence AGSPTAFRLLIAAGPESAARVKGRLRVVSSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHGL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT
TTGGGTTTT

SSS


S

TTT

SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence EHPVRQGSAGYAMPGYRVAVLDEAGKEVGPNEPGVLAIDIDNSPLLWFTGYYKKDTPSISGGYYRTGDTV
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) B



TT

B
TT


SSS
B

TT

STT
TT





SSS

TTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence EFEPDGSISFIGRADDVITSSGYRIGPFDVESALLKHPAVNEAAVVGVPDPQRTEIVKAFVILAPGFEGT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TTS



SS

TT
TSTTTTT
TT



 .........500.........510.........520.........530.........540..
Sequence PELAEELALHVKKQLSAHAYPRQIDFVAELPKTPSGKIQRFLLRKAEVEKQQ
Predicted secondary structure






















SS confidence



















































Known secondary structure (DSSP) S
TTTS
S
S


B
TTS
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D