Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u20C_

Fold library idPDB HeaderMoleculeTitle
c5u20C_1.50PDB header: transferaseChain: C: PDB Molecule: putative aminotransferase;


Added to library: Thu Feb 9 14:18:44 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMFFLNLKQINDRFNTEFITKFKEILESGWYILGKQCEKFENNFAKYCGVKHCIGVANGLDALRLIIKAY
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
B
SS
TTT

BSST
SS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence DFKENDEIIVPANTYIASILAITDNKCKPILIEPDINTYNINPDLIEEKITKKTKAIMVVHLYGQVCDME
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) T

TT
TTS
TT

B
TTTSSB
GGGTGGG

TT
GGGB



 .........150.........160.........170.........180.........190.........200.........210
Sequence KIQLLANKYNLKIIEDCAQAHGAIYKDKRVGNLGDAAGFSFYPGNLGALGDAGCICTNDDNFASKIRALA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T

TT
TT
TTTTSSSS







SS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence NYGSHKKYENLYTGLNSRLDEIQAAFLDIKLKYLDEDNNKRKNIANFYLQNIKNENIILPSNKFDHVWHL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) BTT
SBTTB
SS


B


BTT


TT
B



SS
B

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence FVVKTKLRDELQHYLNNHDIQTIIHYPIPPHKQKCYKDLNHLKLPITENIHQEVLSLPISPTMKENDFKK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TTTTTB

B
S
SS
GGGSGGGGGGTT





TT

 .........360
Sequence VADILNKWKV
Predicted secondary structure

SS confidence









Known secondary structure (DSSP) TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D