Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u1dA_

Fold library idPDB HeaderMoleculeTitle
c5u1dA_3.97PDB header: transport proteinChain: A: PDB Molecule: antigen peptide transporter 1;


Added to library: Thu Feb 9 15:03:05 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLE
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)



SSTTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence FVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLVR
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) S
S
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GLCLLGIMLWVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TT

STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQF
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence TQAVEVLLSIYPRVQKAVGSSEKIFEYLDRGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT



B

SS





SS
SSS
S

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence EVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

B

TTSSTSS

SBS

SSSBGGGB

SS



SSBT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S
SS


T
STTGGGSB

TTSSSS


SBS
ST
 .........500.........510.........520.........530.........540.........550.........560
Sequence ALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T

TT
GGGGG
B
SST
S


TT
S
TS
 .
Sequence A
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D