Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u0mB_

Fold library idPDB HeaderMoleculeTitle
c5u0mB_3.08PDB header: oxidoreductaseChain: B: PDB Molecule: n-succinylglutamate 5-semialdehyde dehydrogenase;


Added to library: Sat Apr 29 08:42:41 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LTGNVYIDGLWLPGHGAPFESVQPVTGETVWDGNAASLEDVDAAVREARKAFLAWRRKSLAERQAVIEAF
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)



TT

SS

TTT
S


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GELLEANKEELAHQIGLETGKPLWESRTEVAAMMGKIPISVKAYNERTGHTESDVAGGHAVLRHRPHGVV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) T


T

TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence AVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPGVAELTVRLWEKAGLPDGVINLVQGGSDTGKCLA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SSSTTTT


TTSTTT

TTS


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence RHSLIDGLFFTGSSTVGHLLHEQFGGQPEKILALEMGGNNPLIVQNVSDLDGAVHHALQSAFLSAGQRCT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T
TT
SS
TTT
TTS




S
S
TSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence CARRLLVPKGKKGDEFLARLVEVAARITVAEFDADPQPFMGSVISAEAANQLLKAQAAMLEKGATSLLEM
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TTT

B

TT
SS

SB


S
TTT


 .........360.........370.........380.........390.........400.........410.........420
Sequence KQLKPDTGLLSPGIVDATGIELEDQEFFGPLLTVYRYKGFDEALELANNTRYGLSAGILSDDRKLYNRLV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
B
STTSS
B


SS








SSSST
SSS
S
 .........430.........440.........450.........460.........470.........480.......
Sequence EEVRAGIVNWNRPLTGASSAAPFGGVGASGNHRPSAYYAADYCAWPMASLEAGKSELPDSLAPGLNF
Predicted secondary structure











































SS confidence


































































Known secondary structure (DSSP)


SSS
SS


TTS

TTBSS

TT
SS



SS

TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D