Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5u03C_

Fold library idPDB HeaderMoleculeTitle
c5u03C_6.10PDB header: ligase, protein fibrilChain: C: PDB Molecule: ctp synthase 1;


Added to library: Sat Apr 29 08:23:43 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S
TTS
T



SS

GGGS
TTTT


TT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S




GGGTTTTT



TTTT


SSS
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence QVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S
S
TT
GGGS
GGG



TTT




T

 .........220.........230.........240.........250.........260.........270.........280
Sequence PDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SSS


T

TTT

SSGGGTTT




SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)





STTSSSSTTT
GGGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
S



SSTTT

TT

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKK
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TTT
SS
S

B

TT
SS
B
S
S

TS
S

 .........500.........510.........520.........530.........540.........550.........
Sequence CLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGC
Predicted secondary structure


























SS confidence




































































Known secondary structure (DSSP) TTTTTTS
SSSSSSSS
GGGT

SSS

T
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D