Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tzsT_

Fold library idPDB HeaderMoleculeTitle
c5tzsT_5.10PDB header: translationChain: T: PDB Molecule: utp21;


Added to library: Fri Feb 10 05:02:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKIFSPFRIIGNVSNGVPFATGTLGSTFYIVTCVGKTFQIYDANTLHLLFVSEKETPSSIVALSAHFHYV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S
S


SS


TT
SSSSSS


SS

SS



SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YAAYENKVGIYKRGIEEHLLELETDANVEHLCIFGDYLCASTDDNSIFIYKKSDPQDKYPSEFYTKLTVT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTTT
SSS

TTTTS
SSTTSSS



 .........150.........160.........170.........180.........190.........200.........210
Sequence EIQGGEIVSLQHLATYLNKLTVVTKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTVTGEV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SSS
S


TT
SSSS
TTTT



SS


SSTTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IMFNMRKGKRIRTIKIPQSRISSLSFRTDGSSHLSVGTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQ
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) SSS
S

S


SSS
SSS
SSS
S

SS
GGGTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ATFLNGQPIIVTSGGDNSLKEYVFDPQPPRYLRSRGGHSQPPSYIAFADSQSHFMLSASKDRSLWSFSLR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TTSSSSS





SS
SSSSS
TTS

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KDAQSQEMSQSKFPEIVALAIENARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTTDDGFVKSVAM
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT



B







TTTTTS

TT
S
SSS
B
SSS

 .........430.........440.........450.........460.........470.........480.........490
Sequence SQCGNFGFIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLLG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
SSS

SSS
TTT



SS

TTSSTTSSSS

 .........500.........510.........520.........530.........540.........550.........560
Sequence KLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDST
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS

SSS
TTTTTTT


SS

TTS
TTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence IRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQSTRTIDESEFXXXXXXXXX
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTTT
SS

SSTTSSSS










SS


 .........640.........650.........660.........670.........680.........690.........700
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T


SS


S




TT
SSS

 .........710.........720.........730.........740.........
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure
















































SS confidence
















































Known secondary structure (DSSP) TT
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D