Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tz8C_

Fold library idPDB HeaderMoleculeTitle
c5tz8C_4.00PDB header: transferaseChain: C: PDB Molecule: glycosyl transferase;


Added to library: Thu Feb 9 16:23:37 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNLKVSQLETNSGG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SS
TTTS
SS
GGG


SSSTTTTTS
SS

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PGKPRNVALKQAEGEFVLFVDSDDYINKETLKDAAAFIDEHHSDVLLIKMKGVNGRGVPQSMFKETAPEV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S

SS

TT

TT

S
SSS




STTSS
BS

 .........150.........160.........170.........180.........190.........200.........210
Sequence TLLNSRIIYTLSPTKIYRTALLKDNDIYFPEELKSAEDQLFTMKAYLNANRISVLSDKAYYYATVSPEDF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SSSSSGGG


S
STTT



SS

SSS
S

SS




T
 .........220.........230.........240.........250.........260.........270.........280
Sequence YEVMRLIAVEILNADLEEAHKDQILAEFLNRHFSFSRTNGFSLKVKLEEQPQWINALGDFIQAVPERVDA
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TSSS
STTTTGGGTS
TTTS
GGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LVMSKLRPLLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFNEGEPYFEGIDKPKVKMTAFKFD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
GGGTT



STT
STT






 .........360.........370.........380.........390.........400.........410.........420
Sequence NHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTMYVPLSVNANKQYRFNIMLEDIKAYLPKEKIWDVFL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS
SS
TTSSTTSS





TTTTTGGG
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence EVQIGTEVFEVRVGNQRNKYAYTAETSALIHLNNDFYRLTPYFTKDFNNISLYFTAITLTDSISMKLKGK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT


SSSBS

SS
TT
B
TT
TTT



TT
 .........500.........510.........520.........530.........540.........550........
Sequence NKIILTGLDRGYVFEEGMASVVLKDDMIMGMLSQTSENEVEILLSKDIKKRDFKNIVKLNTAHMTYSL
Predicted secondary structure




















SS confidence



































































Known secondary structure (DSSP) TSSS
B




SS


SSSSS


TT



SS


B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D