Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5txeA_

Fold library idPDB HeaderMoleculeTitle
c5txeA_2.20PDB header: hydrolaseChain: A: PDB Molecule: atxe2;


Added to library: Thu Feb 9 13:51:29 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence APPVTPEVLVRLADIGTMSASETTPLLSLSPDGRYVAFQVRQADPVTNLNVFRMVVKATDGATDAIDVDV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

B

T

SSSS

TT



TTSSTTTTTTS
S

 .........80.........90.........100.........110.........120.........130.........140
Sequence GGEYLFWTIPSWGYARNAPSGANLTIQPRWSPSGTHLAYLRQDQGRVRVWRASVKGEGASPVIEDAYDIE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

B

B



BTTBSS



S
B





TTSSTTTTSS


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DVQWLDDNTLIYSGRPGFVEAEAEIEREGRRGWVYDERFHPLTGARPRVLEPISIVYQVLDLKTGTRRAA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TT
GGG



STT

TTT
SS


BS



TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TPTEVARLREKPDPLRAMVGRTTFSVSRTDPQNINAPTTLVARRGEGEPVRCDEEACQNITRMWGDETAN
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)




TT
TT
SSTT
TTS

TTS



SGGGBSTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VLYFLRREGWASNEMALYRMPADALKPVRIWHATGLLQGCERQAKRLICAQESALQPRRLVTLNLTSGQM
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SGGG
TTSS

SSTTTTTTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence SPLYDPNPDLSRYRLPKVERLTLRNRNGIEVFSDLVLPPDYQLGTRLPLVIVQYSSRGFLRGGTGDENPI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
SS

GGGSB


TTS

TT

TT


S

SS

SSTTTT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence LPLATAGFAVLSFHSPRSEASYQRFTSPIAQSKAEYSNWRNRWNILHTLEDLIDDLDRRGVIDPARVGLT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT





GGGGS

S
GGGTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence GLADGATTVHFGLINSHRFAAAVTSSCCTDSFTASVMNGPRISGALKAYGIETDQADDGPFWAATSFVVN
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) ST
S

SSS


STTTTGGGT

TTS
TTSTTGGGT
 .........570.........580.........590.........600.........610.........620.........630
Sequence ASRLDTPLLIQSADEEYLGALPGFTALQQARKPVELIIYPNEHHVKWQPAHRLAVYNRTIDWFRFWLMDQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGG

S
GGGTT

TT

SS




 .........640.........650..
Sequence SDPAPDKAAQYDRWRALRALRQ
Predicted secondary structure








SS confidence





















Known secondary structure (DSSP)



GGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D