Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tw7E_

Fold library idPDB HeaderMoleculeTitle
c5tw7E_2.35PDB header: ligaseChain: E: PDB Molecule: gmp synthase [glutamine-hydrolyzing];


Added to library: Thu Feb 9 19:45:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QDKILILDFGSQVTRLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVYESDYQADTGIFD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


S
TTTT
TT



S


SS
TTS
S



GGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGIPVLGICYGMQFMAHHLGGEVQPGNQREFGYAQVKTIDSGLTRGIQDDAPNTLDVWMSHGDKVSKLPD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSS
TTT



TT

S
TTTTT

SSSTT
SS

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GFAVIGDTPSCPIAMMENTEKQFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
TTTTTTSB
TTSTTSTTTTS






 .........220.........230.........240.........250.........260.........270.........280
Sequence EQVGSDEVILGLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAEG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT


SSGGG
S
S
TTTTTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence QFMAKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNAKWLAQGTIYPDVILKLLEPLRDLFKDEVRELGV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT



TT








TTTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence ALGLPREMVYRHPFPGPGLGVRILGEVKKEYADLLRQADDIFIQELRNTTDENGTSWYDLTSQAFAVFLP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT

S




TTGGGGTB
SS


B
TTS
B
S
 .........430.........440.........450.........460.........470.........480.........
Sequence VKSVGVMRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPATIEWE
Predicted secondary structure






































SS confidence




































































Known secondary structure (DSSP)



TTS




STT



BTTS
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D