Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tw1D_

Fold library idPDB HeaderMoleculeTitle
c5tw1D_2.76PDB header: transcription activator/transferase/dnaChain: D: PDB Molecule: dna-directed rna polymerase subunit beta';


Added to library: Thu Feb 9 20:36:19 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VNFFDELRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGI
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)












B


B
TTT

B
TTBTT
TTTT

SBTTB
SS
SS
STTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDDEM
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) B
TTT

B
S
TT

SSS
T

TTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RHNELSTLEAEMAVEKKAVEDQRDADLEARAQKLEADLAELEAEGAKSDVRRKVRDSGEREMRQLRDRAQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TS


 .........220.........230.........240.........250.........260.........270.........280
Sequence RELDRLDEIWNTFTKLAPKQLIVDEVLYRELQDRYGEYFTGAMGAESIKKLIENFDIDAEAESLREVIRS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TT


STTGGG
S

 .........290.........300.........310.........320.........330.........340.........350
Sequence GKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTS


GGGG

GGGS

TTS

 .........360.........370.........380.........390.........400.........410.........420
Sequence LKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRFRQNLLGKRVD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SSSSSSS

B
GGG
B


SSTTSTSS


S
 .........430.........440.........450.........460.........470.........480.........490
Sequence YSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
TTS
TTSTT
SSTT
TTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence HPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLSSN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


SS

SGGGSSSS
TTST

TTT



STTBGGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence NILSPASGKPLAMPRLDMVTGLYYLTTLVEGATGEYQAATKDAPEQGVYSSPAEAIMAMDRGALSVRAKI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

B
TTT

BSSS

T


TT
TT





TTS


SS
TTT

TT


 .........640.........650.........660.........670.........680.........690.........700
Sequence KVRLTELRPPTDLEAQLFENGWKPGDAWTAETTLGRVMFNELLPKSYPFVNEQMHKKVQARIINDLAERF
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) SSSB

STSSS

SS



TTS
TTSB


S


S
 .........710.........720.........730.........740.........750.........760.........770
Sequence PMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPQKQEILERHEAEADAIERKYQRGALNHTERNESL
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
TT



TTTS


TTT
S
 .........780.........790.........800.........810.........820.........830.........840
Sequence VKIWQDATEEVGKALEEFYPADNPIITIVKSGATGNLTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S
TT
TTSS

TT

B

B
TTSSB
SS
B
S
TTT

 .........850.........860.........870.........880.........890.........900.........910
Sequence TVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCETERGINVTLAERGPDIRDAHVE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TT

S










S





S
ST
 .........920.........930.........940.........950.........960.........970.........980
Sequence TSAFARTLATDAVDANGNVIIERGHDLGDPAIDALLAAGITTVKVRSVLTCTSATGVCAMCYGRSMATGK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTTTT

BSS
B

SS


SB
TT



T




TTT


SSS
B
TTTSS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence LVDIGEAVGIVAAQSIGEPGTQLTGGLPRVQELFEARVPRNKAPIADVAGRVRLEESDKFFKITIVPDDG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) B

TT

GGGGG



TT


SS
B
SS

SS
TT
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence GEEVVYDKLSKRQRLRVIGVLSDGDHVEVGDQLMEGAADPHEVLRVQGPREVQIHLVKEVQEVYRAQGVS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
S




GGG


B

B

TT

TT
B
SSS

TT

 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence IHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLTERAEFEAENRRVVAAGRPVLMGITKASLATDSWLSAA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SSS

SSSS

TT








T
S
 .........1200.........1210.........1220.........1230.........1240........
Sequence SFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGISRYRNIQVQPTEEARAAA
Predicted secondary structure

























SS confidence

























































Known secondary structure (DSSP) S
T



ST


SSGGGST







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D