Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tw1C_

Fold library idPDB HeaderMoleculeTitle
c5tw1C_2.76PDB header: transcription activator/transferase/dnaChain: C: PDB Molecule: dna-directed rna polymerase subunit beta;


Added to library: Thu Feb 9 11:18:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEVLAELSPIEDF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

STT





S

SS



TTT
SS
SS





T
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIIN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T
S
S
SS
T


TTT




TTS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVKVIPGRGAWLEFVRIDRKRRQPVTVLLKALGWTNEQI
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T

S




TTT






SBS



TTB
S

TTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence VERFGFSEIMMGTLEKDTTSGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




SSTTS


TTSTTTSB

 .........290.........300.........310.........320.........330.........340.........350
Sequence KLTLTEEDVVATIEYLVRLHEGQTSMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)



T

S

SSS






TTSGGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence VRERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
TTS




TT
SS


SSTTS
STTS

TTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence LEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRH
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S

GGGTTTB
TT


SSTTTTTB
SS

TTS
TT
TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence VVAQANSPTDENGRFTEDRVMVRKKGGEVEFVSADQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S


B
TTS
B
SS
SSS
TTS

SSTTSSS
TTGGGSTTGGGS
 .........570.........580.........590.........600.........610.........620.........630
Sequence NMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVADKTGVIEEVSADYITVMADDGTRQSYRLRKFARSN
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTB


SS



S
STTTS
S
SS

SSTTS



S
B
T
 .........640.........650.........660.........670.........680.........690.........700
Sequence HGTCANQRPIVDAGQRVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TS
B





TT

TT

SSTT


S

TTTS
TT
TTTSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence IHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEER
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT

S

SS

TTGGGGB
TTSBB
TT

TT








 .........780.........790.........800.........810.........820.........830.........840
Sequence LLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRH
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)




S



TT

SSSS


STT


TT
TT
 .........850.........860.........870.........880.........890.........900.........910
Sequence GNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIDVAAGVPDWASKL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S

TTSS
B
TTS
B
S
STTT
T
B

S
SSS

SGGGG
 .........920.........930.........940.........950.........960.........970.........980
Sequence PEELYSAPADSTVATPVFDGAQEGELAGLLGSTLPNRDGEVMVDADGKSTLFDGRSGEPFPYPVTVGYMY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
SSTT
B
TT


SSS


S



SSSS

S

TTS

B
TTT

B
SS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence ILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) BS





SS

B
SSS
SB

STTTT





T
TTTTT
 .........1060.........1070.........1080.........1090.........
Sequence VKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMR
Predicted secondary structure






















SS confidence
















































Known secondary structure (DSSP) TT








TTT




SSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D