Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tsiA_

Fold library idPDB HeaderMoleculeTitle
c5tsiA_3.73PDB header: membrane protein, hydrolaseChain: A: PDB Molecule: cystic fibrosis transmembrane conductance regulator;


Added to library: Fri Feb 10 06:06:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MQRSPVEDANCLSRYFFWWTNPIMRKGFKEKLRPSDVYQAPSQDAADILAERLEKEWDREVASGKKKPSL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



GGGG

T
TTS


TTTS



SSS
S
SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence LRAMARCYIKPFLLFGFLLYIGEATKTVQPQLLGRIIASFDPAHEPERANGYFLAFGLGLLFTARFLLLQ
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTTGGGT
SSSS


 .........150.........160.........170.........180.........190.........200.........210
Sequence PAMFGLHHLGMQIRIALFSIIYKKTLKLSSRVLDKISTGQLVSLMSANLGKFDQSLGMAHFIWISPLQCI
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) TS

TTS
GGGTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LCTGLIWELIDVNSFCALAAISLLGVLQAFLSHKMGPYKAQKVLLTNKRLALTSEIMENLHSVKAYGWEE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) SS
SSSTTTT

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence IMETLIKNIRQDEVKLTRKIGSLRYFYSSAYFFSAIFVIVAAVVPHALSRGINLRRIFTTLSYCMVLRMT
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) SSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence VTRQLPGSIQMWYDTMRLIWKIEEFLSKEEYKLMEYDLSITELELQDVTASWAPVLKDISLKLKKGEMLA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTS










S





S



S




SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence VTGSMGSGKSSLLMTILGELVPSSGKIRHSGRISYSSQTAWIMPGTIRDNILFGLTYDEYRYKSVVKACQ
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
SSSSSSSTSS

SBS




S
B

B
SS



SSSS


STT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LEEDLAALPEKDKTPMAEGGLNLSGGQKARVALARAVYRDADLYLLDAPFTHLDIATEKEIFDKCLCKLM
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SSSGGG

SSSSSS
S

SBB
S


S

TG
 .........570.........580.........590.........600.........610.........620.........630
Sequence ASKTRILVTNKIEHLKRADKILLLHNGESFFYGTFPELQSERPDFSSLLLGLEAYDNISAERRSSILTET
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) GGS





STT
TT
T
SS
TTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence LHRVSTTKWNTYVRYVSNNKSLLYVLIFILFIAAIEIAGSVAGIFLITDELWREEHTSSYYILYIYVATS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



SS
ST


TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence ESLLAMGFFRGLPFVHTTITISKKLHQKMLHAVLSAPMSVLNTMKTGRIMNRFTKDMATIDDMLPLLMFD
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) S


TSS
TTTTTTSTTSSTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence FVQLTVVVVGCILVVSIVRPYIFLAATPLAIIFIVMRKYFLRTGQQLKQLETEARSPIFSHLIMSLKGLW
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) STTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence TIRAFERQAYFEALFHKTLNTHTATWFLYLSTLRWFLFRADILFVFFFTLAAWIAVGTNQDKPGEIGIII
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TT
TSS
S

TT
 .........920.........930.........940.........950.........960.........970.........980
Sequence CLAMLILGTFQWCVATSIAVDGMMRSVDRVFKFIDLPSESSWPHRGQIEVRNLTVKYTEAGHAVLKNLSF
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTS





SS






SB
BSS

STT


SSB

 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence SAEGRQRVGILGRTGSGKSSLFNALLKLVYTDGEISIDGVNWNKMPLQKWRKAFGVVPQKVFIFTGPLRM
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


SS

STTS
TSS
B
S


SSS

TTTS
TS


SS



S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence NLDPYGCHSDEELWRVAEEVGLKTVIEQFPDKLDFQLEYGGYVLSNGHKQLICLARSILSGARILLLDEP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SS



T
STSSSTT


TTT
SS
TT

S


 .........1130.........1140.........1150.........1160.........1170.........1180....
Sequence SAHLDPVTIKVLKKTLRQSFSTCTILLSEHKVEPLLECQSFLMMDKGQVKTYDSIQKLLNETSH
Predicted secondary structure





















SS confidence































































Known secondary structure (DSSP) GGG


SSS
SSSGGGGTSS
BTTB



SSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D