Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5trwA_

Fold library idPDB HeaderMoleculeTitle
c5trwA_1.60PDB header: transferaseChain: A: PDB Molecule: pyridoxal kinase pdxy;


Added to library: Thu Feb 9 16:00:04 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTKNVLSIQSHVVFGHAGNSAAVFPMRRLGVNVWPLNTVQFSNHTQYGHWTGGAIDATQMVELVDGIGAI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


SSS
STT
SS
GGGS




T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GMLPRCDAVLSGYLGTPEQAQSVLEIVKAVKAANPRAWYFCDPVMEPGIQEFLVRTMPGVADAMAPNHTE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T
GGG




SS
TT





TTTGGGT
S


 .........150.........160.........170.........180.........190.........200.........210
Sequence LQRLVGREIETLEEAVTACRELIARGPKLVLVKHLLDRNSPADRFNMLVVTEREAWMGQRPLYPFARQPV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TS


STTS
S

TTS
TTSS




SS

T
 .........220.........230.........240.........250.........260.........270........
Sequence GVGDLTSAVFVARTLLGDSIRAAFEHTLAAVNAVVKATWQAGRYELELVAAQSEIAQPREWFDAWVGD
Predicted secondary structure













SS confidence



































































Known secondary structure (DSSP) TTT

TT
SS

TTTTS
SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D