Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tr9A_

Fold library idPDB HeaderMoleculeTitle
c5tr9A_1.65PDB header: oxidoreductaseChain: A: PDB Molecule: ferredoxin-nadp reductase;


Added to library: Thu Feb 9 12:25:48 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EAKFTEEKILWVKHHTPKLITFAISRPESYRFKAGQFSRLGFYEGKGFIWRAYSVVSAEYADTLEYFAVL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

STT

TT



TT
TT

S
TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IQDGPMSALFAKMQQGDTILLDKNATGFLLPERFPDGKDLVMLCTGSGIAPFLSILEQPEIRQRFDTVNL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TT


TT
S

B



GGGS
TTSGGGGT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence IHSVSFPEELIFNDRLAALSEHSFRFVPVTTRAANPSGLSGKRIPELLKNNSIEQALHTKLTPESTRFMI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSGGG
TT


SSS

SSSSS
TTTS


TTT
 .........220.........230.........240......
Sequence CGNPEMVKDTFQTLLDMGYAMHRNRIPGQIMMENGF
Predicted secondary structure












SS confidence



































Known secondary structure (DSSP)
TT

B

SS


S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D