Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tqbB_

Fold library idPDB HeaderMoleculeTitle
c5tqbB_2.40PDB header: ribosomal proteinChain: B: PDB Molecule: assembly chaperone of ribosomal protein l4 (acl4);


Added to library: Thu Feb 23 10:31:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SINPKELLDRATTLLEEGDIETAAKVARTAYEHIGENGRHAGAALTLLGQIHVELGDIDAARNYYAAAVK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)


TT
TT
TTSTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VDEDGSLPEELGGGPEKFLWLAQLSEEGGHDSVAWFERGATVLRAQIQSLXDSLEQRPLSRGQVEAAIAD
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) STT

S


T
SS
TS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KRRRLAETLCAVVEVYXTDLSWEDDAEQRCEALITEATXIAPEWPETWQTVANVRISQERTEEAREALRR
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTTTT
TT
TT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SLGLWTHLPPEDPGVPPFPSRVSLVRLLIEVDXEEEALEVTERLIAEDDLSVEVWYLGGYARYRLGEKER
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTTTS
TT
TTS

TT

TT
 .........290.........300.........310.........320.........330.....
Sequence EASGQASEPEAWKDTWRSSRKWLRQCLKVFEAEEYEDERLGEHAKELIASIIGEL
Predicted secondary structure











SS confidence






















































Known secondary structure (DSSP) GGGTSS
TTT


T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D