Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tqbA_

Fold library idPDB HeaderMoleculeTitle
c5tqbA_2.40PDB header: ribosomal proteinChain: A: PDB Molecule: 60s ribosomal protein l4-like protein;


Added to library: Thu Feb 23 10:13:12 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RPTVTVFGADGKPTGATEVLPKVFSAPIRPDIVKHVHTGXAKNKRQPYAVSEKAGHQTSAESWGTGRAVA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


TTSS

GGGGS


TTT
SSTT
SS
TT



TTS


TTTT

S


 .........80.........90.........100.........110.........120.........130.........140
Sequence RIPRVGAFGNXCRSGRXFAPTKIWRKWHVKINQGQKRFATASALAASAVAPLLXARGHQVSTVPEVPLVV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)





S
SS







TT
TT


SS
SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DSAAVAGDAVAKTAAAYKLLKAIGAGPDVEKVKKSHRQRRGPLIVYSPEHDGKELVKGFRNIPGVETCPV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
GGGSSSTTS
ST
T





SS


STTSSS
G
 .........220.........230.........240.....
Sequence DALNLLQLAPGGHLGRFIVWTSAAIKQLDAVYESK
Predicted secondary structure











SS confidence


































Known secondary structure (DSSP) GG

SGGG






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D