Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tpwB_

Fold library idPDB HeaderMoleculeTitle
c5tpwB_2.91PDB header: transport proteinChain: B: PDB Molecule: glutamate receptor ionotropic, nmda 2a;


Added to library: Thu Feb 9 16:32:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LNIAVLLGHSHDVTEDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

STT









STTS

S
SS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence FIPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


GGGG


S


TT

S


TT


SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence VDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TSTT
S




TTS
TT


SS
TT
SSTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence VSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILTTAASSMLEKFSYIPEAKASCYGTPLHTLHQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SS


TTS
TT
S

TTS
TTTSSSS




S
S



S

SST
 .........290.........300.........310.........320.........330.
Sequence FMVNVTWDGKDLSFTEEGYQVHPRLVVIVLNKDREWEKVGKWENQTLSLRH
Predicted secondary structure
















SS confidence


















































Known secondary structure (DSSP) TTSS
TT

B
TTSSBSS


TTT
TTTT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D