Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tj5P_

Fold library idPDB HeaderMoleculeTitle
c5tj5P_3.90PDB header: motor proteinChain: P: PDB Molecule: v-type proton atpase subunit d;


Added to library: Thu Feb 9 11:07:03 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VYFNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSSTDYGNFLSSVSSESLTTSLIQEYAS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S
STTTTS

T

SSTT
SSTTTTTSS


 .........80.........90.........100.........110.........120.........130.........140
Sequence SKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITLQRCHPLGWFDTLPTXXXXXXXXXXXXXXXX
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

S



SSS

GGGGTT

STTT
SSTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence XXXXNIEIIRNKLYKAYLEDFYNFVTEEIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) GGG

TTSS




GGGG

TT
 .........220.........230.........240.........250.........260.........
Sequence XLEDHFYQLEMELCRDAFTQQFAISTVWAWMKSKEQEVRNITWIAECIAQNQRERINNY
Predicted secondary structure






SS confidence


























































Known secondary structure (DSSP)

T

TT
TTT

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D