Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tj5A_

Fold library idPDB HeaderMoleculeTitle
c5tj5A_3.90PDB header: motor proteinChain: A: PDB Molecule: v-type proton atpase subunit a;


Added to library: Thu Feb 9 14:52:11 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

S









S
 .........80.........90.........100.........110.........120.........130.........140
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)










SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T

TTTT
















TT
SSS
SSTTS

TTT

SS




SSS

TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQYREINAGLPTIVTFPFMFAIMFGHGFLM
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

TTTT

T



SSS

STTTT


T
 .........290.........300.........310.........320.........330.........340.........350
Sequence TLAALSLVLNEKKINKMKRGEIFDMAFTGRYIILLMGVFSMYTGFLYNGTENALLFSNSYKMKLSILMGF
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T

ST



S

TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IHMTYSYFFSLANHLDIIGNFIPGLLFMQGIFGYLSVCIVYKWAVDWVKDGKPAPGLLNMLINMFLSPGT
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) S




STTTTTTTTTS
SSSTT



STTT
TT

 .........430.........440.........450.........460.........470.........480.........490
Sequence IDDELYPHQAKVQVFLLLMALVCIPWLLLVKPLHFKFDIMIHQVIHTIEFCLNCVSHTASYLRLWALSLA
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTS


SS
T


TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence HAQLSSVLWTMTIQIAFGFRGFVGVFMTVALFAMWFALTCAVLVLMEGTSAMLHSLRLHWVESMSKPYEP
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTS

ST

 .........570
Sequence FAFEYKDMEV
Predicted secondary structure









SS confidence









Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D