Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tj3A_

Fold library idPDB HeaderMoleculeTitle
c5tj3A_1.70PDB header: hydrolaseChain: A: PDB Molecule: alkaline phosphatase pafa;


Added to library: Thu Feb 9 12:19:04 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAVPRPKLVVGLVVDQMRWDYLYRYYSKYGEGGFKRMLNTGYSLNNVHIDYVPTVAIGHTSIFTGSVPSI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





STT

TTTGGG

SSSSS


SS



S

 .........80.........90.........100.........110.........120.........130.........140
Sequence HGIAGNDWYDKELGKSVYCTSDETVQPVGTTSNSVGQHSPRNLWSTTVTDQLGLATNFTSKVVGVSLKDR
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)


SSTTTTTTB
TTS
S
S

B
STT

S

TTT
S

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ASILPAGHNPTGAFWFDDTTGKFITSTYYTKELPKWVNDFNNKNVPAQLVANGWNTLLPINQYTESSEDN
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
SS
STTTTTTT
SS

TTTTT
B

SS
GGG
TTS

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence VEWEGLLGSKKTPTFPYTDLAKDYEAKKGLIRTTPFGNTLTLQMADAAIDGNQMGVDDITDFLTVNLAST
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TT



TT
SSS
S
BTT
GGGGGGSTTTTSSSS

 .........290.........300.........310.........320.........330.........340.........350
Sequence DYVGHNFGPNSIEVEDTYLRLDRDLADFFNNLDKKVGKGNYLVFLSADHGAAHSVGFMQAHKMPTGFFDM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTST
TTS
S





TT
S


 .........360.........370.........380.........390.........400.........410.........420
Sequence KKEMNAKLKQKFGADNIIAAAMNYQVYFDRKVLADSKLELDDVRDYVMTELKKEPSVLYVLSTDEIWESS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
S

TT
T

TSTTTTSSTTSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence IPEPIKSRVINGYNWKRSGDIQIISKDGYLSAYSKKGTTHSVWNSYDSHIPLLFMGWGIKQGESNQPYHM
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TT

TTTS
S
TT
SS
SSS



SSS
TTB
S
S
G
 .........500.........510.........
Sequence TDIAPTVSSLLKIQFPSGAVGKPITEVIG
Predicted secondary structure















SS confidence




























Known secondary structure (DSSP) GGT



TT





TTTB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D