Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5thyB_

Fold library idPDB HeaderMoleculeTitle
c5thyB_2.09PDB header: transferase,lyaseChain: B: PDB Molecule: curj;


Added to library: Fri Feb 10 03:23:54 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LLDPVEVSQQLAPSLTELVTLLDNARTSEIGTQLEELSVDYIVQGLLQXGWSYQPTESFDLDAAAQCLGV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


TTS
TT



TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence VPTQVRLFERLLQILAEVGILQSNQQQWQVQKTAQKVNPSKQSQSLLSQYPDEAATLTLLERCASQLSGV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
GGGTTSTT
S






GGGTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LRGEIDPVQLVFPQGDLTTATQLYKDSAVAKVXNTIVEKVIXKAXEKLPPSRGIRLLEIGAGTGGTTSYI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
S
TS
TT

STTS
TT

S
TT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LPHLNPNQTEYIFTDIGALFTSKAQEKFQDYRFLGYQTLDIEVDPSSQGFESHRYDVIIAANVLHATTSL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) GGGS
TTTS
TTT
TT

TTS
GGGTT

TT
S
GGGSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KQTLSHVRQLLAPGGILVLYEATTRSRWVDLIFGLLEGWWKFTDYELRPDYPLLNREQWKKVLSETGFTQ
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S

TTGGGSGGGG



TTT
SS
S


TT
 .........360.........370......
Sequence VVTLPEVEGXAEALSQQTVIVAQAAS
Predicted secondary structure















SS confidence

























Known secondary structure (DSSP)


TT

GGGTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D