Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tgtA_

Fold library idPDB HeaderMoleculeTitle
c5tgtA_2.45PDB header: ligaseChain: A: PDB Molecule: glutamate--trna ligase;


Added to library: Thu Feb 9 12:01:16 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TTVRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQIYDALRWLGIEWDE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)





SSS

BTT

B


STTS

T


SB
 .........80.........90.........100.........110.........120.........130.........140
Sequence GPDVGGPHGPYRQSERGHIYKKYSDELVEKGHAFTCFMHLPKDEVQRRLAAGESHVTRMKVPTEGVCVVP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) BTTTB
TT


BGGGSTTTTS




TT






SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DMLRGDVEIPWDRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQ
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTTGGG



TTS
B
TT

GGGSTTT



 .........220.........230.........240.........250.........260.........270.........280
Sequence LCYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSEKFTLAEMIEHFDLSRVSLGGPI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


B
TTS
B

TTTS

BTT







T

GGG

SS

B
 .........290.........300.........310.........320.........330.........340.........350
Sequence FDLEKLSWLNGQWIREQSVEEFAREVQKWALNPEYLMKIAPHVQGRVENFSQIAPLAGFFFSGGVPLDAS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SS
T
STT
SSGGGGGGTSSS



GG
 .........360.........370.........380.........390.........400.........410.........420
Sequence LFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERITGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) GG

SS


SS

TT

SSSS
S
 .........430.........440.........450.........460.
Sequence DAMEILGADLSRYRLRQALELLGGASKKETKEWEKIRDAIP
Predicted secondary structure





SS confidence








































Known secondary structure (DSSP)
T


T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D