Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tgfB_

Fold library idPDB HeaderMoleculeTitle
c5tgfB_1.81PDB header: hydrolaseChain: B: PDB Molecule: uncharacterized protein;


Added to library: Thu Feb 9 11:25:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TYDFTPLDSIISSWXDKGYYPGGAICVVKNDSVLFEKAYGSFTGDTKVYVASAGKWVAAAVIGAVVDRTD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)



TTS
S
TTTT

TT


GGGSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LSWDDPVEKWLPQFRGDAKGGILLRQLLSHTSGVRPYLPAPRVDNYNHLDSAVTEILSLDTVFTPGTRFE
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)

TT
B
GGGTTSGGGG
BTTT
S


SS

TT




SSTS

SS
TTSB

 .........150.........160.........170.........180.........190.........200.........210
Sequence YGGLAXQIAGRXAEVAXGKEFEPLFQELIAAPLGXTHSHFAPVNTDGGHAPXLGGGLCTTLNDYIRFLKX
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

STS
TT

S
BS
S


SSSS
S


 .........220.........230.........240.........250.........260.........270.........280
Sequence IYHNGRSGNREILKPETVQTXQADQVRNAVVAPGEYVEKALGQHHTSIYGLGEWRELVDEATGEAYQISS
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TTTTTSS
S

STTSB

TT




S

B
SSS
TTT


 .........290.........300.........310.........320.........330...
Sequence PGWAGAYPWINKRDGVYGFFIAHVQGEANKKDGFSSFYGSPVLSETVTKIVNQ
Predicted secondary structure























SS confidence




















































Known secondary structure (DSSP)

TTS
TTTT


SS
SB
TTS
BTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D