Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tfmA_

Fold library idPDB HeaderMoleculeTitle
c5tfmA_2.92PDB header: cell adhesionChain: A: PDB Molecule: cadherin-23;


Added to library: Sat Dec 30 09:03:52 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NVPTFQKDAYVGALRENEPSVTQLVRLRATDEDQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


SSS
TT
S






SS
GGGTT
S


GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SGGG
S
SS








S
SSS

TT





SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence REYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTSGGG
S
TT
TTT
SS


TTT


S

GGG



 .........220.........230.........240.........250.........260.........270.........280
Sequence NDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLD
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)




SS
S
TT

TT




S

SS

TT
TTT

SS


 .........290.........300.........310.........320
Sequence RENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLL
Predicted secondary structure

















SS confidence







































Known secondary structure (DSSP) TT
S
TTS

SS

B
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D