Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5te4G_

Fold library idPDB HeaderMoleculeTitle
c5te4G_2.75PDB header: immune systemChain: G: PDB Molecule: hiv-1 clade g strain x2088 gp120;


Added to library: Thu Feb 9 16:16:23 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence WEDADTTLFCASDAKAYSTEKHNVWATHACVPTDPDPQEIPLENVTENFNMWKNNMVEQMHEDIISLWDE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)








TT

S

SS


S

STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SLKPCVMLTGGSTIKQACPKVTFEPIPIHYCAPAGFAILKCRDEDFNGTGPCKNVSTVQCTHGIKPVVST
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S

STT













TT

SS

SSSSB


B




S
 .........150.........160.........170.........180.........190.........200.........210
Sequence QLLLNGSLAKGDIVIRSENLTNNAKVIIVQLNEPVQIVCIRPDIRQAHCNVTRGKWVNITKNVKEQLWKI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SS



SSS

S
TT
SSS


TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence FNKTTNITFNNTIFNSPAGGDLEITTHSFNCGGEFFYCNTSDLFNETNNENITLQCRIKQIVRMWQRVGQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S


S


SS

TTT

TTTT
S





S
SSSSS
 .........290.........300.........310.........320.........330.........340.
Sequence AMYAPPIAGNITCISNITGLLLTRDGVNDTHDKENETFRPTGGDMRDNWRSELYKYKVIKL
Predicted secondary structure

























SS confidence




























































Known secondary structure (DSSP)




SS




TT


S



TTTSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D