Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5td8A_

Fold library idPDB HeaderMoleculeTitle
c5td8A_7.53PDB header: replicationChain: A: PDB Molecule: kinetochore protein ndc80;


Added to library: Thu Feb 9 11:57:25 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DPRPLRDKNFQSAIQEEIYDYLKKNKFDIETNHPISIKFLKQPTQKGFIIIFKWLYLRLDPGYGFTKSIE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

S
SS
TT
STTTT



SS

STT



S
GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence NEIYQILKNLRYPFLESINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQTLDEQ
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GTT
TTGGG

S

SSTT

TTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DQRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFVHIINTDVTSTELKLEELKVDLN
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
S
SSSSS
 .........220.........230.........240.........250......
Sequence RKRYKLHQQVIHVIDITSKFKINIQSSLENSENELGNVIEELRNLE
Predicted secondary structure

SS confidence













































Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D