Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5tbzD_

Fold library idPDB HeaderMoleculeTitle
c5tbzD_7.00PDB header: transcription/rnaChain: D: PDB Molecule: dna-directed rna polymerase subunit beta';


Added to library: Thu Feb 9 13:55:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ALASPDMIRSWSFGEVKKPEKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIW
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)



TSB
S







SS
SSSSS
TTSS
SS

TTT


S


S
TTT
B



B
SS


ST
 .........80.........90.........100.........110.........120.........130.........140
Sequence FLKSLPSRIGLLLDMPLRDIERVLILTEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDLEQECEQLREE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTS
SS
ST

T



S
S





STGGGGG

STTGGGTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVIN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
SST
SSS



TTTTS
SB




STTS



SSSS




TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence RNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTS


S


SS

S

SSSSSS


SSSS
S




T
 .........290.........300.........310.........320.........330.........340.........350
Sequence KRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S
SS





SSS
TT


SSSSSSSSSST

 .........360.........370.........380.........390.........400.........410.........420
Sequence VIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEARALM
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTS
SS

STTSS




SS
B

SST

SSS




SSTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence MSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSGLASLHARVKVRITE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) BTTT

B
SSSSSBS



TSS

SSTTTS




STTSSS
S

S





 .........500.........510.........520.........530.........540.........550.........560
Sequence YEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKAISKMLNTCYRILGLKPTVIFADQI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



SSSSS







TTT

S
S

STTTSS

TTT
STT
 .........570.........580.........590.........600.........610.........620.........630
Sequence MYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVS
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)




STTS


S
TTSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence KAMMDNLQTETVINRDGQEEKQVSFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T


B

SS

B





TTTTT
SS
SSB





SSS


S



SBSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence EGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEP
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S


STSS

B
SS











SSS
SS
 .........780.........790.........800.........810.........820.........830.........840
Sequence LRDRVLGRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYGRDLA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) STT


SS


TTTS
SS
SS


SSS

S




SSS
S

SSB




S
 .........850.........860.........870.........880.........890.........900.........910
Sequence RGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHASRAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) SSSS

SS


TTT

S
TT



TTTTTS
S
S



B
SSS


S
 .........920.........930.........940.........950.........960.........970.........980
Sequence NTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

SS

B



B

S
SS
SS

SS


TT
SS
T

BTTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence QTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSS



TTTS
SSTTS



TTSSB
B
SSSSSBS

TT


SS

SS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence DTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


S







STT


SS


B

SSS
B


S

SSSSS




SSSS




 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence MIPKWRQLNVFEGERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


SSS
B
S
SSB


SS
B
BSS


T
S



 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence QMLRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFISAASFQET
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT

S
SSS
TTS
TTTS
STT






T

S
TTTS
 .........1270.........1280.........1290.........1300..
Sequence TRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRM
Predicted secondary structure























SS confidence









































Known secondary structure (DSSP) TT





ST




TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D