Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5t91A_

Fold library idPDB HeaderMoleculeTitle
c5t91A_1.53PDB header: hydrolaseChain: A: PDB Molecule: glycerophosphoryl diester phosphodiesterase;


Added to library: Fri Feb 10 00:27:17 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NLLSPDRILTVAHRGASGYVPEHTILSYETAQKMKADFIELDLQMTKDGKLIVMHDEKLDRTTNGMGWVK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT
TTS
TTTTTTTS
TTSTT
S

TTS

SSSBSTTTSS

SBGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DHTLADIKKLDAGSWFNEAYPEKAKPQYVGLKVPTLEEVLDRFGKHANYYIETKSPDTYPGMEEKLIASL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) GS
TTS
SS
GGG

GGGTT



BGGGS


TTTSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QKHKLLPGQVIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDAALEEIKTYAVGAGPDYKALNQEN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT



SS

TTS

T

TTT
SBGGG

 .........220.........230.........240.........250........
Sequence VRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTNYPDLFHKVKKGY
Predicted secondary structure















SS confidence















































Known secondary structure (DSSP) TT


B



T

S
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D