Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5t8vA_

Fold library idPDB HeaderMoleculeTitle
c5t8vA_2.80PDB header: cell cycleChain: A: PDB Molecule: putative uncharacterized protein;


Added to library: Thu Feb 9 13:26:08 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GESLDLRQRANVALHELKAYLQAAFQAVDRAIAQKSSNEMAIFLSETEATLAAPTQTKLQSALKKTIELN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




SSS

SS
SSS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CFMTVPLDDLIYLLRLCDSALRQTESLDFSVQTSWGAQDVEQWLELLPNLEAAIRAARTSMRIMCGGREE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
GGGS
STSS





TT

TTTTTTS



 .........150.........160.........170.........180.........190.........200.........210
Sequence KQLYSENAIEQALSLCKRLIDGIIMPLAELRNTSDTEELFKALSSCKRRILPLMTDAQKLLSMMSELIAK
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) GGG

T



TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VDTSETVTNALEFAASQLLFIETANAERDSVIETQKFDGFRLVAMDMICQIFLLNPSQRQGIIDEILTSL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S


T



SSTTSSSS

GGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence EKLPLGKRARTFKLADGSSIQPVSALIMRLVQTSAGIIQSEAQGASQHSTAIRDLDTISTPLLETARNNA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTS
GGGSS


TTS

GGG



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence SYVIKFIVNRALNSPYRNLLDLFVEDFITCLDNPDWPAAELLLRLLMLMMVGLVENDKSSIMAKNMALEL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



TTT
TT
T
SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence LGTMCAAISKLRGHVRKMASALEADELSLFLSDLAASALELKSRPEHMVAWTGPYRATLEYLQSRSNEDA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TS



TT


T
TTS



 .........500.........510.........520.........530.........540.........550.........560
Sequence QLSSAMTFIISEWGSKICTCYDGYQDDVLERDQELGRLAYRLREMILDRKWLSTEYTYKDVSPLQAKLSY
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S


TT






 .........570.........580.........590.........600.........610.........620.........630
Sequence SIILLRSQFCEAFGAILNILLNSMASDQPTVRSKSLKSINQVMEADPTILDGDSVVVQLILRSSSDSSTQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TSTTGGGGGG
SSTT
GGGGSSS
TT
SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence VRDSALGLISKCISLRPALEEKMTETVVNRFSDAGPGVRKRAMKLAKDIYLRNSNRVLRSAIANGLLHRV
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TGGG
SS


TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence QDPEESVRDLARQVIEEIWFAPSLSEHVILMVQTVKRGNVANVLDKVLQALLSPSSKTSQASMEVCRKLV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) S
SSTS


SS
SSSSSSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence GSMFDLIDNNDASAPSGRDVLQVLMIFAKAEASLFTFEQLRLLRPYIASIGTSEDLTVSRAVVVIYRRVL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT



SS



GGG

TTSGGGT


G
 .........850.........860.........870.........880.........890.........900.........910
Sequence PQLSSAHAQFLTDVRKELLPVVAKVPRALLDDVMACLWIISTLLGTYEPLARLVISSLKGIQKTRASAQV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) GG
SS

SGGGGTS
SS

TT
 .........920.........930.........940.........950.........960.........970.........980
Sequence QPLDQLKIRQFDRYSLIVGMAGKHCNLDSHHEMFKEHFPKFSGASVSKLMVDIVVPFAAPSWPLDVRKPA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S


TT


GGGTTTTTTTSTT

SS
SGGGGSTTS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence LDCVGLVCQSSPRNYVAANVYTAFQQVFDDQIPILETMVLRSLKEFLFSEEKRSETNYDDVASATTHRFL
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) SGGGTTST




 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence KDITRIATSTQDDHAFLAVEVLASINRQGLVHPKETGVTFITLATSTHPRISELAFLEHKALHTKHETVI
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TT

ST
S
GGGTTT
SS
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence EREYAKAIQSIFAYQRDIVKDPRGATTNPFTPKLHLFMEVLKISKAKNRVKFLEKLVSQIDFDIAKLELP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT
TS



SB
SSS

BTT
TTT


SS




 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence PHVQYSRFIIENLAFFEYVTVGEIHSLVAAMERLVASTGASVAQVIESEVRLRQLTAASMILLAIWEVRT
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) S


S


 .........1270.........1280.........1290.........1300.........1310.....
Sequence YLRRLYSLARPPVKVQGVTGDKVWEEINNIMGALSGGRERMVRACKDLVELMSID
Predicted secondary structure



















SS confidence






















































Known secondary structure (DSSP) S








TT

STTGGGS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D