Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5t6qA_

Fold library idPDB HeaderMoleculeTitle
c5t6qA_2.70PDB header: oxidoreductaseChain: A: PDB Molecule: cytochrome p450 4b1;


Added to library: Thu Feb 23 12:16:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GFLKLLRLLLRRQRLARAMDSFPGPPTHWLFGHALEIQKTGSLDKVVTWTQQFPYAHPLWVGQFIGFLNI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTS




BTTTBTTSTTSSSSSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YEPDYAKAVYSRGDPKAPDVYDFFLQWIGKGLLVLDGPKWFQHRKLLTPGFHYDVLKPYVAIFADSTRIM
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
STT


B
GGGTTTT
SSTTT

SSTTSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LEKWEKKACEGKSFDIFSDVGHMALDTLMKCTFGKGHRDSSYYVAVSELTLLMQQRIDSFQYHNDFIYWL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTT


S




GGG
STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TPHGRRFLRACRAAHDHTDRVIRQRKAALQDEKEREKHLDFLDILLDVRGESGVQLSDTDLRAEVDTFMF
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) STTTS



TGGG
S
S


 .........290.........300.........310.........320.........330.........340.........350
Sequence EGHDTTTSGISWFLYCMALYPEHQQRCREEVREILGDQDSFQWEDLAKMTYLTMCMKECFRLYPPVPQVY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TT
SS

GGGGTT
S
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence RQLSKPVSFVDGRSLPAGSLISLHIYALHRNSDVWPDPEVFDPLRFSPENSSGRHPYAFIPFSAGPRNCI
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)
SS

TTS

TT
TT
TTTSSSTTS

GGGGSTTTTTT

TTSS
TT

GGGS
T
 .........430.........440.........450.........460.........470..
Sequence GQQFAMNEMKVVTALCLLRFEFSVDPLRLPIKLPQLVLRSKNGIHLYLKPLG
Predicted secondary structure

















SS confidence



















































Known secondary structure (DSSP) T

TTS


SSSTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D