Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5t5mB_

Fold library idPDB HeaderMoleculeTitle
c5t5mB_2.50PDB header: oxidoreductaseChain: B: PDB Molecule: tungsten formylmethanofuran dehydrogenase subunit fwdb;


Added to library: Thu Feb 9 12:39:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEYVKNVVCPFCGTLCDDIICKVEGNEIVGTINACRIGHSKFVHAEGAMRYKKPLIRKNGEFVEVSYDEA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


SSBTT



SSSSS

S

TT

B

S
SSSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence IDKAAKILAESKRPLMYGWSCTECEAQAVGVELAEEAGAVIDNTASVCHGPSVLALQDVGYPICTFGEVK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SS
TTS
T
GGGGTT





 .........150.........160.........170.........180.........190.........200.........210
Sequence NRADVVVYWGCNPMHAHPRHMSRNVFARGFFRERGRSDRTLIVVDPRKTDSAKLADIHLQLDFDRDYELL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
SS

STTTTS
BTTBTTGGGG

SS

T
S


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DAMRACLLGHEILYDEVAGVPREQIEEAVEVLKNAQFGILFFGMGITHSRGKHRNIDTAIMMVQDLNDYA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT


SSSTTT
SS
SSTTTTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KWTLIPMRGHYNVTGFNQVCTWESGYPYCVDFSGGEPRYNPGETGANDLLQNREADAMMVIASDPGAHFP
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)



BTTS
SSS
TTSS

TTTSSTT

SS

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence QRALERMAEIPVIAIEPHRTPTTEMADIIIPPAIVGMEAEGTAYRMEGVPIRMKKVVDSDLLSDREILER
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTS

SB

T
S




BTTTB

TTS



S

SS

 .........
Sequence LLEKVREYK
Predicted secondary structure
SS confidence








Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D