Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5t5mA_

Fold library idPDB HeaderMoleculeTitle
c5t5mA_2.50PDB header: oxidoreductaseChain: A: PDB Molecule: tungsten formylmethanofuran dehydrogenase subunit fwda;


Added to library: Thu Feb 9 12:45:31 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEYIIKNGFVYCPLNGVDGEKMDICVKDGKIVESVSDSAKVIDASGKIVMPGGVDPHSHIAGAKVNVGRM
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
GGGTTTS


TTS
TTS


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YRPEDSKRDAEKFKGGRAGSGFSVPSTFMTGYRYAQMGYTTAMEAAMPPLLARHTHEEFHDTPIIDHAAY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) T
S

TTS


SSS

TT
GGGTSBS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PLFGNNWFVMEYLKEGDVDACAAYASWLLRATKGYTIIVNPAGTEAWGWGGNVHGIYDPAPYFDITPAEI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

TT
TT
T




BSTTTTT



STT


TTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence IKGLAEVNEKLQLPHSIHLHCNDLGHPGNYETTLASFDVPKNIKPNPATGSRDTVLYATHVQFHSYGGTT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
SS
B
SSTT
TTTTTTTS



SSS



S

GGGG
B
SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence WRDFVSEAPKIADYVNKNDHIVIDVGQITLDETTTMTADGPMEYDLHSLNGLKWANCDVELETGSGVVPF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SSS

B

SS





SS






BTTTB

 .........360.........370.........380.........390.........400.........410.........420
Sequence IYSARAPVPAVQWAIGMELFLLIDNPEKVCLTTDSPNAGPFTRYPRVIAWLMSNKYRMNLIEGELHKWAQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TTS
S
GGG


TTTTSS
GGG
TTS
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence RKSTVATIDREYTFSEIAQITRATSAKVLGLSDTKGHLGVGADADIAVYDINPETVDPSAEYMAIEEAFS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
SGGG





TTT
TTTSS

STTSB

S

TTT

TTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence RAACVLKDGEIVVKDGEVVASPHGRTYWVDTQVDESIYSEVLANVESKFKQYYSVNFANYPVQDDYLPKS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S
STTTT



B






SS
GGG
S

GGG
TT
 ........
Sequence APVKGVML
Predicted secondary structure







SS confidence







Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D