Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5t0gV_

Fold library idPDB HeaderMoleculeTitle
c5t0gV_4.40PDB header: hydrolaseChain: V: PDB Molecule: 26s proteasome non-atpase regulatory subunit 3;


Added to library: Thu Feb 9 11:33:58 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTVTLEDIKEHVKQLEKAVS
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
SSSTTS

SSS

TTTT
S
S
TTSST
 .........80.........90.........100.........110.........120.........130.........140
Sequence GKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAST
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TS


SSS





GGGT



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVV
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) GGG


SSSS

SS

TS


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence RSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKA
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT

SSS
SS
S

SS
TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT
T






SS



GGGG

 .........360.........370.........380.........390.........400.........410.........420
Sequence RTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFI
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SS
TT
S
TTTTT

SS
 .........430.........440.........450.........460.........470.........480
Sequence VAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFP
Predicted secondary structure


















SS confidence



























































Known secondary structure (DSSP) TTS



TTTT




SSGGGS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D