Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5szsC_

Fold library idPDB HeaderMoleculeTitle
c5szsC_3.40PDB header: viral proteinChain: C: PDB Molecule: spike glycoprotein;


Added to library: Thu Feb 9 11:06:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ANLSMLQLGVPDNSSTIVTGLLPTHWFCANQSTSVYSANGFFYIDVGNHRSAFALHTGYYDANQYYIYVT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



T

SSSS











S

SSS

SS

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence NEIGLNASVTLKICKFSRSSSFDCIVNLLFTEQLGAPLGITISGETVRLHLYNVTRTFYVPAAYKLTKLS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSS




TT
TTTT
TTGGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence VKCYFNYSCVFSVVNATVTVNVTTHNGRVVNYTVCDDCNGYTDNIFSVQQDGRIPNGFPFNNWFLLTNGS
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

GGGT

S
TT
S

TT


B
GGG


TT


TT



BSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TLVDGVSRLYQPLRLTCLWPVPGLKSSTGFVYFNATGSDVNCNGYQHNSVVDVMRYNLNFSANSLDNLKS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


SS



TTS

B
SSS

TT


SB



S

S


S
GGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence GVIVFKTLQYDVLFYCSNSSSGVLDTTIPFGPSSQPYYCFINSTINTTHVSTFVGILPPTVREIVVARTG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SS
SSS
GGG



SS

TT

S
TTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QFYINGFKYFDLGFIEAVNFNVTTASATDFWTVAFATFVDVLVNVSATNIQNLLYCDSPFEKLQCEHLQF
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TT
S

S

SSSTTTT

ST
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence GLQDGFYSANFLDDNVLPETYVALPIYYQHTDINFTATASFGGSCYVCKPHQVNISLNGNTSVCVRTSHF
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S

S









S






SS
SSS

STTBS


SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence SIRYIYNRVKSGSPGDSSWHIYLKSGTCPFSFSKLNNFQKFKTICFSTVEVPGSCNFPLEATWHYTSYTI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
GGGGSS
GGGG


SSSS
GGGTTSS


SS

TT
TTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence VGALYVTWSEGNSITGVPYPVSGIREFSNLVLNNCTKYNIYDYVGTGIIRSSNQSLAGGITYVSNSGNLL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


SS


S
SS

B


SS
TT




S
S
TTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence GFKNVSTGNIFIVTPCNQPDQVAVYQQSIIGAMTAVNESRYGLQNLLQLPNFYYVSNGGNNCTTAVMTYS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TTSS

SS

TTSSSS

SS

TTS

S

S
T
 .........710.........720.........730.........740.........750.........760.........770
Sequence NFGICADGSLIPVRPRNSSDNGISAIITANLSIPSNWTTSVQVEYLQITSTPIVVDCATYVCNGNPRCKN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTS













SSS





TTTTTSTT
TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence LLKQYTSACKTIEDALRLSAHLETNDVSSMLTFDSNAFSLANVTSFGDYNLSSVLPQRNIRSSRIAGRSA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) GGGG



T
GGGTGGG

TTTS

S

SSS
S



 .........850.........860.........870.........880.........890.........900.........910
Sequence LEDLLFSKVVDVDYKSCTKGLSIADLACAQYYNGIMVLPGVADAERMAMYTGSLIGGMVLGGLTSAAAIP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)



GGGGGS
SS


TTT


SS
TTT

S
STT



 .........920.........930.........940.........950.........960.........970.........980
Sequence FSLALQARLNYVALQTDVLQENQKILAASFNKAINNIVASFSSAEAIHTVTIALNKIQDVVNQQGSALNH
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) TTS



SS


T
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence LTSQLRHNFQAISNSIQAIYDRLDSIQADQQVDRLITGRLAALNAFVSQVLNKYTEVRGSRRLAQQKINE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) GGG


SSS
S
TTS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence CVKSQSNRYGFCGNGTHIFSIVNSAPDGLLFLHTVLLPTDYKNVKAWSGICVDGIYGYVLRQPNLVLYSD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTT



TTSSSSSTTS
TTTSSTT
 .........1130.........1140.........1150.........1160.........1170.......
Sequence NGVFRVTSRVMFQPRLPVLSDFVQIYNCNVTFVNISRVELHTVIPDYVDVNKTLQEF
Predicted secondary structure




























SS confidence
























































Known secondary structure (DSSP) TTSSS


B


GGG
S


SSS
TTGGGGTSTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D