Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5szqA_

Fold library idPDB HeaderMoleculeTitle
c5szqA_2.61PDB header: cell adhesionChain: A: PDB Molecule: protocadherin gamma-a4;


Added to library: Thu Feb 9 15:17:04 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGEVTYSFRNVREKISQLFQLNSLTGDITVLGELDYE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


SSSTT

TT



S




SS


TTT
SS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DSGFYDVDVEAHDGPGLRARSKVLVTVLDVNDNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T
S
SSS











TT

S




SS
GGGT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LVTCSIPDNLPFRLEKTYGNYHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


SSS

TT

S


TTT
S
SSS









 .........220.........230.........240.........250.........260.........270.........280
Sequence TFTHASYSAYIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPMSSYVSINSNTGVLYALRSF
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SSSSS

TT

SS
GGGG




TTGGGT
SSSSS

 .........290.........300.........310.........320.........330.........340.........350
Sequence DYEQFQDLKLLVTARDSGTPPLSSNVSLSLSVLDQNDNTPEILYPTISTGVELTPRSADPGYLVTKVVAV
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
TTT


SSSS









S



S
TT

TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence DKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVTVQDHGQPPLSATVTLTIAV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SS
GGGG
SSTTT
TTT
SS


TTS
S
SSS

 ..
Sequence SD
Predicted secondary structure
SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D