Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5syrA_

Fold library idPDB HeaderMoleculeTitle
c5syrA_1.80PDB header: hydrolaseChain: A: PDB Molecule: probable atp synthase spal/mxib;


Added to library: Thu Feb 9 19:21:35 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LHTQVGRGLLGAVVNPLGEVTDKFAVTDNSEILYRPVDNAPPLYSERAAIEKPFLTGIKVIDSLLTCGEG
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
SGGGTT
TTS
S


S



S





GGGB



S

S
S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QRMGIFASAGCGKTFLMNMLIEHSGADIYVIGLIGERGREVTETVDYLKNSEKKSRCVLVYATSDYSSVD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TTS
S

S
S
T
TTGGG
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAGPVSVFDSLPRLLERPGKLKAGGSITA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT
T



GGGTS
BTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FYTVLLEDDDFADPLAEEVRSILDGHIYLSRNLAQKGQFPAIDSLKSISAVFTQVVDEKHRIMAAAFREL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SSS


SS
TT
SS
B
GGG
TTS
 .........290.........300.........310.........320.........330.........340
Sequence LSEIEELRTIIDFGEYKPGENASQDKIYNKISVVESFLKQDYRLGFTYEQTMELIGETIR
Predicted secondary structure

















SS confidence



























































Known secondary structure (DSSP) TT


TTS
TT


TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D