Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5swcE_

Fold library idPDB HeaderMoleculeTitle
c5swcE_1.45PDB header: lyaseChain: E: PDB Molecule: carbonic anhydrase;


Added to library: Thu Feb 9 20:19:25 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSHMQRLIEGLQKFREGYFSSHRDLFEQLSHGQHPRILFICCSDSRVDPNLITQSEVGDLFVIRNAGNII
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTGGG
TT






TT

TT

TTSTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence PPYGAANGGEGAAMEYALVALEINQIIVCGHSHCGAMKGLLKLNSLQEKLPLVYDWLKHTEATRRLVLDN
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

TTS

STS


TT
TTGGGGTTT
GGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence YSHLEGEDLIEVAVAENILTQLKNLQTYPAIHSRLHRGDLSLHGWIYRIEEGEVLAYDGVLHDFVAPQSR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TT

TTST

TTTTTTTT


TT
 .........220...
Sequence INALEPEDEYALH
Predicted secondary structure












SS confidence












Known secondary structure (DSSP)

S

GGG





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D