Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5swaB_

Fold library idPDB HeaderMoleculeTitle
c5swaB_3.00PDB header: hydrolaseChain: B: PDB Molecule: extracellular solute-binding protein;


Added to library: Thu Feb 9 15:13:22 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KPVIKMYQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFADNYIVN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SB


S
S

BSTTTT


S
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFAFNGTLLAKYGIDISGV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTT
B


TTTTTTTSTTS
TT


SS
SSBT


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGLPFVIDLEGDTTKVVNRYEVPRFKEHLK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SSSGGG
TTS


TT




S
S

TT

TTS
TT
GGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TLHKFYEAGYIPKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TSS
TTTTT





TTSSS
GGGTTTTS

S

BB
TGGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence VANFVISNNSKNKEKSMEILNLLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTBTT
TT
T
SBTTT
TTSTTB
TTTSSSSS

GGGTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence NNWILYINENVTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKAI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
GGGS
B
TT

T

B
TTTT



GGGGTTTTTSS
 .........430.........440.........450
Sequence PELMEKLKSEGAYEKVLNEMQKQYDEFLKN
Predicted secondary structure




SS confidence





























Known secondary structure (DSSP) TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D