Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oynB_

Fold library idPDB HeaderMoleculeTitle
c5oynB_2.70PDB header: lyaseChain: B: PDB Molecule: dehydratase, ilvd/edd family;


Added to library: Sat Jan 27 08:33:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NRTPRRFRSRDWFDNPDHIDMTALYLERFMNYGITPEELRSGKPIIGIAQTGSDISPCNRIHLDLVQRVR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)






TTT
SS
TTTTS

S




BTTBTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGIRDAGGIPMEFPVHPIFENCRRPTAALDRNLSYLGLVETLHGYPIDAVVLTTGCDTTPAGIMAATTVN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T





TTT
SS
TTT
S



T
 .........150.........160.........170.........180.........190.........200.........210
Sequence IPAIVLSGGPMLDGWHENELVGSGTVIWRSRRKLAAGEITEEEFIDRAASSAPSAGHCNTMGTASTMNAV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)



B



BSSS
B

TTTT
S
ST

SSSB
SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AEALGLSLTGCAAIPAPYRERGQMAYKTGQRIVDLAYDDVKPLDILTKQAFENAIALVAAAGGSTNAQPH
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT
S
TT
SSS
TTSTT



T

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IVAMARHAGVEITADDWRAAYDIPLIVNMQPAGKYLGERFHRAGGAPAVLWELLQQGRLHGDVLTVTGKT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT



TTTT

B
B
BTTTSSB
TTTT
S
TT
B
TTSSB
 .........360.........370.........380.........390.........400.........410.........420
Sequence MSENLQGRETSDREVIFPYHEPLAEKAGFLVLKGNLFDFAIMKSSVIGEEFRKRYLSQPGQEGVFEARAI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT


S
TTTB

TTS
SBS

S

BSSS
S
GGG

S

SS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence VFDGSDDYHKRINDPALEIDERCILVIRGAGPIGWPGSAEVVNMQPPDHLLKKGIMSLPTLGDGRQSGTA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SS
GGG


SSS
STTTTTS

B






TTT




SSB

TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence DSPSILNASPESAIGGGLSWLRTGDTIRIDLNTGRCDALVDEATIAARKQDGIPAVPATMTPWQEIYRAH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S

S
GGGT
GGGS

TT
TTTT


TTS








S
 .........570.........580........
Sequence ASQLDTGGVLEFAVKYQDLAAKLPRHNH
Predicted secondary structure




















SS confidence



























Known secondary structure (DSSP) B

TTTTS
BTTGGG


GGGS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D