Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oynB_

Fold library idPDB HeaderMoleculeTitle
c5oynB_2.70PDB header: lyaseChain: B: PDB Molecule: dehydratase, ilvd/edd family;


Added to library: Sat Jan 27 08:33:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NRTPRRFRSRDWFDNPDHIDMTALYLERFMNYGITPEELRSGKPIIGIAQTGSDISPCNRIHLDLVQRVR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)






TTT
SS
TTTTS

S




BTTBTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGIRDAGGIPMEFPVHPIFENCRRPTAALDRNLSYLGLVETLHGYPIDAVVLTTGCDTTPAGIMAATTVN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T





TTT
SS
TTT
S



T
 .........150.........160.........170.........180.........190.........200.........210
Sequence IPAIVLSGGPMLDGWHENELVGSGTVIWRSRRKLAAGEITEEEFIDRAASSAPSAGHCNTMGTASTMNAV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)



B



BSSS
B

TTTT
S
ST

SSSB
SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AEALGLSLTGCAAIPAPYRERGQMAYKTGQRIVDLAYDDVKPLDILTKQAFENAIALVAAAGGSTNAQPH
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT
S
TT
SSS
TTSTT



T

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IVAMARHAGVEITADDWRAAYDIPLIVNMQPAGKYLGERFHRAGGAPAVLWELLQQGRLHGDVLTVTGKT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT



TTTT

B
B
BTTTSSB
TTTT
S
TT
B
TTSSB
 .........360.........370.........380.........390.........400.........410.........420
Sequence MSENLQGRETSDREVIFPYHEPLAEKAGFLVLKGNLFDFAIMKSSVIGEEFRKRYLSQPGQEGVFEARAI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT


S
TTTB

TTS
SBS

S

BSSS
S
GGG

S

SS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence VFDGSDDYHKRINDPALEIDERCILVIRGAGPIGWPGSAEVVNMQPPDHLLKKGIMSLPTLGDGRQSGTA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SS
GGG


SSS
STTTTTS

B






TTT




SSB

TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence DSPSILNASPESAIGGGLSWLRTGDTIRIDLNTGRCDALVDEATIAARKQDGIPAVPATMTPWQEIYRAH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S

S
GGGT
GGGS

TT
TTTT


TTS








S
 .........570.........580........
Sequence ASQLDTGGVLEFAVKYQDLAAKLPRHNH
Predicted secondary structure




















SS confidence



























Known secondary structure (DSSP) B

TTTTS
BTTGGG


GGGS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D