Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oygA_

Fold library idPDB HeaderMoleculeTitle
c5oygA_4.06PDB header: membrane proteinChain: A: PDB Molecule: anoctamin-1;


Added to library: Sat Dec 23 08:34:38 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDYHEDDKRFRREELCREAEFLKLKMPTKKVYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S





TTTT


SSS


GGGTTS



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SYPFSREKQHLFDLTDRDSFFDSKTRSTIVYEILKRTTCGITSLLANGVYSAAYPLHDGDYEGDNVEFND
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SSSS

SS
S


SS
S




TS

B

SS
SS
SS
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence RKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSM
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TS
TTS
SS



TGGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence EMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S


BB

SSSSS



BTTTS
S
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence WDLTGFEEEEEAVKDHPRAEYEARVLEKSPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSP
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S






TT
S





STTS
SGGGTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFY
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)






S

SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence VAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKRKQRYEVDF
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TSSSSS


SSS

TTT




TT
TT





 .........500.........510.........520.........530.........540.........550.........560
Sequence NLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWY
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TSB



STS
SS


TTB







SS
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence NILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTT

S
SSSS





TT


SS
S
SS


SSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence EVQICRYKDYREPPWSEHKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


B
SS
B

TTSSS
SSB
S
SS
 .........
Sequence VLMVELFMR
Predicted secondary structure

SS confidence








Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D