Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oygA_

Fold library idPDB HeaderMoleculeTitle
c5oygA_4.06PDB header: membrane proteinChain: A: PDB Molecule: anoctamin-1;


Added to library: Sat Dec 23 08:34:38 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDYHEDDKRFRREELCREAEFLKLKMPTKKVYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S





TTTT


SSS


GGGTTS



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SYPFSREKQHLFDLTDRDSFFDSKTRSTIVYEILKRTTCGITSLLANGVYSAAYPLHDGDYEGDNVEFND
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SSSS

SS
S


SS
S




TS

B

SS
SS
SS
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence RKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSM
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TS
TTS
SS



TGGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence EMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S


BB

SSSSS



BTTTS
S
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence WDLTGFEEEEEAVKDHPRAEYEARVLEKSPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSP
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S






TT
S





STTS
SGGGTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFY
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)






S

SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence VAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKRKQRYEVDF
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TSSSSS


SSS

TTT




TT
TT





 .........500.........510.........520.........530.........540.........550.........560
Sequence NLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWY
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TSB



STS
SS


TTB







SS
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence NILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTT

S
SSSS





TT


SS
S
SS


SSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence EVQICRYKDYREPPWSEHKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


B
SS
B

TTSSS
SSB
S
SS
 .........
Sequence VLMVELFMR
Predicted secondary structure

SS confidence








Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D