Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oydA_

Fold library idPDB HeaderMoleculeTitle
c5oydA_2.10PDB header: hydrolaseChain: A: PDB Molecule: cellulase, putative, cel5d;


Added to library: Sat Feb 10 08:29:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GLYPSYNTSPAAPDSTGMQSTAVQLAGKIRLGWNIGNTMEAIGGETAWGNPMVSNELLKLVKDSGFDAVR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

S




S
B



TT



T
S

TTSTT
TTSTTTTS




T

 .........80.........90.........100.........110.........120.........130.........140
Sequence IPVAWDQYANQESAEISAAWLNRVKQVVQMAIDNELYVLINIHWDGGWLENNITPAKKDENNAKQKAFWE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



GGGB
TTT

B
TT




GGGTTTT

STTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QIATHLRDFDEHLLFAGTNEPNAENAEQMDVLNSYLQTFVDAVRSTGGKNAYRVLVLQGPVTDIEKTNEL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT

TT

S




STBGGGGT


GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence WTHMPADTATDRLMAEVHFYTPYNFALMRQDESWGKQFYYWGEGFLSTTDTERNPTWGEEATIDQLFDLM
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)






SSSS




ST

S
BTTB





STT


SSSGGGS
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence KTKFVDQGIPVVLGEFSAMRRTNLTGDALTLHLAGRAYYHKYVTQQALARGLLPFYWDNGGNDNFSSGIF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTTT






TT

TT





STT


S
 .........360.........370
Sequence NRQQNTVFDQQVLDALLEGA
Predicted secondary structure









SS confidence



















Known secondary structure (DSSP) TTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D