Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5oydA_

Fold library idPDB HeaderMoleculeTitle
c5oydA_2.10PDB header: hydrolaseChain: A: PDB Molecule: cellulase, putative, cel5d;


Added to library: Sat Feb 10 08:29:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GLYPSYNTSPAAPDSTGMQSTAVQLAGKIRLGWNIGNTMEAIGGETAWGNPMVSNELLKLVKDSGFDAVR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

S




S
B



TT



T
S

TTSTT
TTSTTTTS




T

 .........80.........90.........100.........110.........120.........130.........140
Sequence IPVAWDQYANQESAEISAAWLNRVKQVVQMAIDNELYVLINIHWDGGWLENNITPAKKDENNAKQKAFWE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



GGGB
TTT

B
TT




GGGTTTT

STTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QIATHLRDFDEHLLFAGTNEPNAENAEQMDVLNSYLQTFVDAVRSTGGKNAYRVLVLQGPVTDIEKTNEL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT

TT

S




STBGGGGT


GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence WTHMPADTATDRLMAEVHFYTPYNFALMRQDESWGKQFYYWGEGFLSTTDTERNPTWGEEATIDQLFDLM
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)






SSSS




ST

S
BTTB





STT


SSSGGGS
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence KTKFVDQGIPVVLGEFSAMRRTNLTGDALTLHLAGRAYYHKYVTQQALARGLLPFYWDNGGNDNFSSGIF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTTT






TT

TT





STT


S
 .........360.........370
Sequence NRQQNTVFDQQVLDALLEGA
Predicted secondary structure









SS confidence



















Known secondary structure (DSSP) TTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D