Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ovnB_

Fold library idPDB HeaderMoleculeTitle
c5ovnB_2.94PDB header: viral proteinChain: B: PDB Molecule: pol protein;


Added to library: Sat Jan 20 10:40:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SDKIPVVKVKMKDPNKGPQIKQWPLTNEKIEALTEIVERLEREGKVKRADPNNPWNTPVFAIKKKSGKWR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S






S
TT


B






TTS

TT


B


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MLIDFRELNKLTEKLGLPHPAGLQIKKQVTVLDIGDAYFTIPLDPDYAPYTAFTLPRKNNAGPGRRFVWC
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)









GGGGG
S

SGGGGSB

TTTGGGG


GGGSS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLPQGWILSPLIYQSTLDNIIQPFIRQNPQLDIYQYMDDIYIGSNLSKKEHKEKVEELRKLLLWPEDKLQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) B

TT
TTSSSTTTT
S
T




 .........220.........230.........240.........250.........260.........270.........280
Sequence EETWTIQQKQLDIPEQPTLNELQKLAGKINWASQAIPDLSIKALTNMMRGNQNLNSTRQWTKEARLEVQK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTS










SS
BTTTSSS


T
S


TT
B



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AKKAIEEQVQLGYYDPSKELYAKLSLVGPHQISYQVYQKDPEKILWYGKMSRQKKKAENTCDIALRACYK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT

GGG

TTS


STTTTTT

SSS


 .........360.........370.........380.........390.........400.....
Sequence IREESIIRIGKEPRYEIPTSREAWESNLINSPYLKAPPPEVEYIHAALNIKRALS
Predicted secondary structure

















SS confidence






















































Known secondary structure (DSSP) TSS

SS
TTTTTTTTTT
SS

SS






T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D