Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ovnB_

Fold library idPDB HeaderMoleculeTitle
c5ovnB_2.94PDB header: viral proteinChain: B: PDB Molecule: pol protein;


Added to library: Sat Jan 20 10:40:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SDKIPVVKVKMKDPNKGPQIKQWPLTNEKIEALTEIVERLEREGKVKRADPNNPWNTPVFAIKKKSGKWR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S






S
TT


B






TTS

TT


B


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MLIDFRELNKLTEKLGLPHPAGLQIKKQVTVLDIGDAYFTIPLDPDYAPYTAFTLPRKNNAGPGRRFVWC
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)









GGGGG
S

SGGGGSB

TTTGGGG


GGGSS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLPQGWILSPLIYQSTLDNIIQPFIRQNPQLDIYQYMDDIYIGSNLSKKEHKEKVEELRKLLLWPEDKLQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) B

TT
TTSSSTTTT
S
T




 .........220.........230.........240.........250.........260.........270.........280
Sequence EETWTIQQKQLDIPEQPTLNELQKLAGKINWASQAIPDLSIKALTNMMRGNQNLNSTRQWTKEARLEVQK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTS










SS
BTTTSSS


T
S


TT
B



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AKKAIEEQVQLGYYDPSKELYAKLSLVGPHQISYQVYQKDPEKILWYGKMSRQKKKAENTCDIALRACYK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT

GGG

TTS


STTTTTT

SSS


 .........360.........370.........380.........390.........400.....
Sequence IREESIIRIGKEPRYEIPTSREAWESNLINSPYLKAPPPEVEYIHAALNIKRALS
Predicted secondary structure

















SS confidence






















































Known secondary structure (DSSP) TSS

SS
TTTTTTTTTT
SS

SS






T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D