Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ovnA_

Fold library idPDB HeaderMoleculeTitle
c5ovnA_2.94PDB header: viral proteinChain: A: PDB Molecule: pol protein;


Added to library: Sat Jan 20 10:27:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QIKQWPLTNEKIEALTEIVERLEREGKVKRADPNNPWNTPVFAIKKKSGKWRMLIDFRELNKLTEKGAQL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)







TS

TT






TTS


TTGGGTS





 .........80.........90.........100.........110.........120.........130.........140
Sequence GLPHPAGLQIKKQVTVLDIGDAYFTIPLDPDYAPYTAFTLPRKNNAGPGRRFVWCSLPQGWILSPLIYQS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S


GGGS


S

S
SSSS


TTTGGGG

SSSSSS


SS
TT
S
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence TLDNIIQPFIRQNPQLDIYQYMDDIYIGSNLSKKEHKEKVEELRKLLLWWGFETPEDKLQEEPPYTWMGY
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TTTT
S
TTT



GGG


SSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELHPLTWTIQQKQLDIPEQPTLNELQKLAGKINWASQAIPDLSIKALTNMMRGNQNLNSTRQWTKEARLE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SS
SS





SS
BSS



T

S


SSSB



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence VQKAKKAIEEQVQLGYYDPSKELYAKLSLVGPHQISYQVYQKDPEKILWYGKMSRQKKKAENTCDIALRA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS


B



TTS


STTTTTT

SSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence CYKIREESIIRIGKEPRYEIPTSREAWESNLINSPYLKAPPPEVEYIHAALNIKRALSMIKDAPIPGAET
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TSS

S
STTTTTS
SS








SS






B

SS

TTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence WYIDGGRKLGKAAKAAYWTDTGKWQVMELEGSNQKAEIQALLLALKAGSEEMNIITDSQYVINIILQQPD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SSS

SSS




S
TTTS
SB
S


S
 .........500.........510.........520.........530
Sequence MMEGIWQEVLEELEKKTAIFIDWVPGHKGIPGNEEVDKLC
Predicted secondary structure













SS confidence







































Known secondary structure (DSSP)

STTT
SBB


TTS

TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D