Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ovnA_

Fold library idPDB HeaderMoleculeTitle
c5ovnA_2.94PDB header: viral proteinChain: A: PDB Molecule: pol protein;


Added to library: Sat Jan 20 10:27:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QIKQWPLTNEKIEALTEIVERLEREGKVKRADPNNPWNTPVFAIKKKSGKWRMLIDFRELNKLTEKGAQL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)







TS

TT






TTS


TTGGGTS





 .........80.........90.........100.........110.........120.........130.........140
Sequence GLPHPAGLQIKKQVTVLDIGDAYFTIPLDPDYAPYTAFTLPRKNNAGPGRRFVWCSLPQGWILSPLIYQS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S


GGGS


S

S
SSSS


TTTGGGG

SSSSSS


SS
TT
S
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence TLDNIIQPFIRQNPQLDIYQYMDDIYIGSNLSKKEHKEKVEELRKLLLWWGFETPEDKLQEEPPYTWMGY
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TTTT
S
TTT



GGG


SSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELHPLTWTIQQKQLDIPEQPTLNELQKLAGKINWASQAIPDLSIKALTNMMRGNQNLNSTRQWTKEARLE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SS
SS





SS
BSS



T

S


SSSB



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence VQKAKKAIEEQVQLGYYDPSKELYAKLSLVGPHQISYQVYQKDPEKILWYGKMSRQKKKAENTCDIALRA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS


B



TTS


STTTTTT

SSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence CYKIREESIIRIGKEPRYEIPTSREAWESNLINSPYLKAPPPEVEYIHAALNIKRALSMIKDAPIPGAET
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TSS

S
STTTTTS
SS








SS






B

SS

TTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence WYIDGGRKLGKAAKAAYWTDTGKWQVMELEGSNQKAEIQALLLALKAGSEEMNIITDSQYVINIILQQPD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SSS

SSS




S
TTTS
SB
S


S
 .........500.........510.........520.........530
Sequence MMEGIWQEVLEELEKKTAIFIDWVPGHKGIPGNEEVDKLC
Predicted secondary structure













SS confidence







































Known secondary structure (DSSP)

STTT
SBB


TTS

TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D