Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ot4D_

Fold library idPDB HeaderMoleculeTitle
c5ot4D_3.00PDB header: transport proteinChain: D: PDB Molecule: interaptin;


Added to library: Sat Dec 16 08:26:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMILEEYIRMAKNKEFFDALEEIAESAKNDETLRNELAKVLDDILKTDPSDPEAFRKIVAEHQEFWDEHD
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)









STTT
S
TTST
 .........80.........90.........100.........110.........120.........130.........140
Sequence PSLMEFNEGKSRKQYLKSDDFLNSTDPTYNFQKLHQFAAEQRVKLGLEKSDTDTLVAILKNNPEECRAYI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GGGT






TTSTTTS
TT
SSS
TTTT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ESKKPGLGNFSEGNVHGWLKEEYTPTIPPKAINKSTGVLSDEAIKRIKEQARDLLLLKLINSSGNTQLLK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTTTTT


STTTSTT




SSSS




TTTS



 .........220.........230.........240.........250.........260.........270.........280
Sequence DLRDAMSKPEAERAANALGFPTEGNGVLFLSREVVDALEERVEKLEQEAAKRGFDSYVQSLSHNALLAKK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) T
SSTT

TTGGGG



TT

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence NGLESTTAAGFKNSLDEPYKTYLPESEWERAQGVLGARYLQAVLSSGTQNLKDALNAKDANALITELKKP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T
SSTS
S
GGGTTT

S


SSSST
 .........360.........370.........380.........390.........400.........410.........420
Sequence ALLGPHDYIDKAVTEENLGSLKKNMMKSFINNIKDETNLKALDALKALDGAKNLDKFKEVLGKLGITPAD
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TTT
S
SGGG


TTTT


BTTB


ST



T
 .........430.........440.........450.........460.........470.........480.........490
Sequence WVKDTDLKDMKQWARARQFELEINRVSSLGSGAHSKLMSTLTKLPVEKQREILAKPQQLRHLMNAYESHV
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) T


SS
GGG
S
TT
TS

S
 .........500.........510.........520.........530.........540.........550.........560
Sequence AEHYLGKNASGIAELLTENKRLEGFRAIHNAEVARVLANFKPEITLNDKQVAAINQALTTANSNPNTYTQ
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SS
S
TTSSSS
SS




TT
TTTTTS
 .........570.........580.........590.........600.........610.........620.........630
Sequence ATDYKILIDAIKTQSGSVNQKDFYNAFNLNDDGRAFTSSTPRKDEMSKQQQHNQHIYAEYNSTSNSGNKK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) STTT
S

TTTB
SSSS
B
SS
T


 .........640.........650.........660.........670.........680.........690.........700
Sequence LLAVLLSIEKPVTFSKDIVNRFLRPLKDSETPQDYADTLFGENPTNPANKKFKDDLLRELTPTVFNEIKN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTS

SS


TTTSTTTT
SS
SS
S
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence DLRKQELLDTNPAHVMTAIKALSTELESIKGITGPIRTNADKLKFINDIDPAQMKERYEGLSRDCGLVVD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TS
SSTT


TTT
 .........780.........790.........800.........810.........820.........830......
Sequence QLRRQVVALEGHLKSLPKEGEFTLEQKAEIKKLRTDLEAELSAVREDLDFYKKIQGKLETIVKEVD
Predicted secondary structure






SS confidence

































































Known secondary structure (DSSP) SS
SSS


TTTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D