Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ot4D_

Fold library idPDB HeaderMoleculeTitle
c5ot4D_3.00PDB header: transport proteinChain: D: PDB Molecule: interaptin;


Added to library: Sat Dec 16 08:26:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMILEEYIRMAKNKEFFDALEEIAESAKNDETLRNELAKVLDDILKTDPSDPEAFRKIVAEHQEFWDEHD
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)









STTT
S
TTST
 .........80.........90.........100.........110.........120.........130.........140
Sequence PSLMEFNEGKSRKQYLKSDDFLNSTDPTYNFQKLHQFAAEQRVKLGLEKSDTDTLVAILKNNPEECRAYI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GGGT






TTSTTTS
TT
SSS
TTTT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ESKKPGLGNFSEGNVHGWLKEEYTPTIPPKAINKSTGVLSDEAIKRIKEQARDLLLLKLINSSGNTQLLK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTTTTT


STTTSTT




SSSS




TTTS



 .........220.........230.........240.........250.........260.........270.........280
Sequence DLRDAMSKPEAERAANALGFPTEGNGVLFLSREVVDALEERVEKLEQEAAKRGFDSYVQSLSHNALLAKK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) T
SSTT

TTGGGG



TT

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence NGLESTTAAGFKNSLDEPYKTYLPESEWERAQGVLGARYLQAVLSSGTQNLKDALNAKDANALITELKKP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T
SSTS
S
GGGTTT

S


SSSST
 .........360.........370.........380.........390.........400.........410.........420
Sequence ALLGPHDYIDKAVTEENLGSLKKNMMKSFINNIKDETNLKALDALKALDGAKNLDKFKEVLGKLGITPAD
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TTT
S
SGGG


TTTT


BTTB


ST



T
 .........430.........440.........450.........460.........470.........480.........490
Sequence WVKDTDLKDMKQWARARQFELEINRVSSLGSGAHSKLMSTLTKLPVEKQREILAKPQQLRHLMNAYESHV
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) T


SS
GGG
S
TT
TS

S
 .........500.........510.........520.........530.........540.........550.........560
Sequence AEHYLGKNASGIAELLTENKRLEGFRAIHNAEVARVLANFKPEITLNDKQVAAINQALTTANSNPNTYTQ
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SS
S
TTSSSS
SS




TT
TTTTTS
 .........570.........580.........590.........600.........610.........620.........630
Sequence ATDYKILIDAIKTQSGSVNQKDFYNAFNLNDDGRAFTSSTPRKDEMSKQQQHNQHIYAEYNSTSNSGNKK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) STTT
S

TTTB
SSSS
B
SS
T


 .........640.........650.........660.........670.........680.........690.........700
Sequence LLAVLLSIEKPVTFSKDIVNRFLRPLKDSETPQDYADTLFGENPTNPANKKFKDDLLRELTPTVFNEIKN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTS

SS


TTTSTTTT
SS
SS
S
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence DLRKQELLDTNPAHVMTAIKALSTELESIKGITGPIRTNADKLKFINDIDPAQMKERYEGLSRDCGLVVD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TS
SSTT


TTT
 .........780.........790.........800.........810.........820.........830......
Sequence QLRRQVVALEGHLKSLPKEGEFTLEQKAEIKKLRTDLEAELSAVREDLDFYKKIQGKLETIVKEVD
Predicted secondary structure






SS confidence

































































Known secondary structure (DSSP) SS
SSS


TTTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D